PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr3P13370_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 357aa    MW: 39807.6 Da    PI: 6.513
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr3P13370_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox231.4e-072803132154
                            HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            k +yp+++++++L +++gL+ +q+ +WF N+R +
  GSMUA_Achr3P13370_001 280 KWPYPTEDDKARLVQETGLQLKQINNWFINQRKR 313
                            469*****************************87 PP

2ELK29.12.2e-10234255122
                    ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                            ELKh+L+++Y+++++++++E++
  GSMUA_Achr3P13370_001 234 ELKHELKQGYKEKIVDIREEIL 255
                            9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012554.1E-2066110IPR005540KNOX1
PfamPF037906.8E-1868109IPR005540KNOX1
SMARTSM012567.2E-28121176IPR005541KNOX2
PfamPF037912.7E-20126175IPR005541KNOX2
PfamPF037898.0E-7234255IPR005539ELK domain
PROSITE profilePS512139.969234254IPR005539ELK domain
SMARTSM011886.1E-4234255IPR005539ELK domain
PROSITE profilePS5007111.612254317IPR001356Homeobox domain
SuperFamilySSF466898.13E-16256321IPR009057Homeodomain-like
SMARTSM003893.9E-11256321IPR001356Homeobox domain
CDDcd000865.94E-11257318No hitNo description
Gene3DG3DSA:1.10.10.607.6E-26261319IPR009057Homeodomain-like
PfamPF059202.4E-17274313IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MPGGGGPTWL NSAILRQQAH HYADGSFLHL QTTSDSSASP VPVSSQSAEA VAQGGGTGGE  60
GTWQNARYKA EILAHPLYEQ LLAAHVACLR IATPVDQLPR IDAQLAQSQQ VVSKYSVLGN  120
SGQLLGDDKE LDQFMTHYVL LLCSFKEQLQ QHVRVHAMEA VMACWELEQS LQSLTGVSPG  180
EGTGATMSDD DEDDQADSET NLFDGGFDGT DSMGFGPLIP TESERSLMER VRQELKHELK  240
QGYKEKIVDI REEILRKRRA GKLPGDSTSM LKAWWQSHSK WPYPTEDDKA RLVQETGLQL  300
KQINNWFINQ RKRNWHSNAS SSSSLKTKRK RFAIHRCSKA FLSFLPTSSF YLELKTE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1310330RKRNWHSNASSSSSLKTKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009392148.10.0PREDICTED: homeobox protein knotted-1-like 13
SwissprotP480001e-176KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLM0SEA40.0M0SEA4_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P13370_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56438169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.21e-165KNOTTED1-like homeobox gene 3